Iright
BRAND / VENDOR: Proteintech

Proteintech, 13516-1-AP, CHRNA5 Polyclonal antibody

CATALOG NUMBER: 13516-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CHRNA5 (13516-1-AP) by Proteintech is a Polyclonal antibody targeting CHRNA5 in WB, ELISA applications with reactivity to human, mouse, rat samples 13516-1-AP targets CHRNA5 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, A431 cells, A549 cells, mouse bladder tissue, mouse stomach tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Nicotinic acetylcholine receptors (nAChRs), such as CHRNA5, are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be (hetero)pentamers composed of homologous subunits. Variants in the CHRNA5 gene are associated with nicotine dependence and lung cancer risk. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4447 Product name: Recombinant human CHRNA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-251 aa of BC033639 Sequence: GAQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYSFVIKRLPL Predict reactive species Full Name: cholinergic receptor, nicotinic, alpha 5 Calculated Molecular Weight: 468 aa, 53 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC033639 Gene Symbol: CHRNA5 Gene ID (NCBI): 1138 RRID: AB_2080670 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P30532 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924