Iright
BRAND / VENDOR: Proteintech

Proteintech, 13517-1-AP, SPARCL1 Polyclonal antibody

CATALOG NUMBER: 13517-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SPARCL1 (13517-1-AP) by Proteintech is a Polyclonal antibody targeting SPARCL1 in WB, IP, IHC, ELISA applications with reactivity to human samples 13517-1-AP targets SPARCL1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human heart tissue Positive IP detected in: Raji cells Positive IHC detected in: human tonsillitis tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SPARC-like protein 1 (SPARCL1), also known as SC1 or Hevin, is an extracellular matrix glycoprotein that belongs to the SPARC family. SPARCL1 is widely expressed in normal and cancer tissues, and has been shown to regulate cellular adhesion and migration. SPARCL1 has been implicated in tumor initiation, formation, and progression of various cancers, including pancreatic, prostate, bladder, ovarian, breast and non-small cell lung cancers. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4448 Product name: Recombinant human SPARCL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 316-664 aa of BC033721 Sequence: VSEALLMEPTDDGNTTPRNHGVDDDGDDDGDDGGTDGPRHSASDDYFIPSQAFLEAERAQSIAYHLKIEEQREKVHENENIGTTEPGEHQEAKKAENSSNEEETSSEGNMRVHAVDSCMSFQCKRGHICKADQQGKPHCVCQDPVTCPPTKPLDQVCGTDNQTYASSCHLFATKCRLEGTKKGHQLQLDYFGACKSIPTCTDFEVIQFPLRMRDWLKNILMQLYEANSEHAGYLNEKQRNKVKKIYLDEKRLLAGDHPIDLLLRDFKKNYHMYVYPVHWQFSELDQHPMDRVLTHSELAPLRASLVPMEHCITRFFEECDPNKDKHITLKEWGHCFGIKEEDIDENLLF Predict reactive species Full Name: SPARC-like 1 (hevin) Calculated Molecular Weight: 664 aa, 75 kDa Observed Molecular Weight: 130-140 kDa GenBank Accession Number: BC033721 Gene Symbol: SPARCL1 Gene ID (NCBI): 8404 RRID: AB_10598475 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14515 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924