Iright
BRAND / VENDOR: Proteintech

Proteintech, 13526-1-AP, ZnT6 Polyclonal antibody

CATALOG NUMBER: 13526-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZnT6 (13526-1-AP) by Proteintech is a Polyclonal antibody targeting ZnT6 in WB, ELISA applications with reactivity to human samples 13526-1-AP targets ZnT6 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A375 cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2400 Background Information ZnT6 (encoded by SLC30A6) is a member of zinc transporters. ZnT6 is localized on the membrane of the Golgi apparatus as well as cytoplasmic vesicles. It may function in transporting the cytoplasmic zinc into the Golgi apparatus as well as the vesicular compartment. Altered expression of ZnT6 may correlate to neural diseases including Alzheimer's disease. Several isoforms of ZnT6 exist due to the alternative splicing, with MW around 48-56 kDa. Specification Tested Reactivity: human Cited Reactivity: human, mouse, chicken, yellow catfish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4403 Product name: Recombinant human SLC30A6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 286-501 aa of BC032525 Sequence: MSVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKDDWIRPALLSGPVAANVLNFSDHHVIPMPLLKGTDDLNPVTSTPAKPSSPPPEFSFNTPGKNVNPVILLNTQTRPYGFGLNHGHTPYSSMLNQGLGVPGIGATQGLRTGFTNIPSRYGTNNRIGQPRP Predict reactive species Full Name: solute carrier family 30 (zinc transporter), member 6 Calculated Molecular Weight: 460 aa, 50 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC032525 Gene Symbol: ZnT6 Gene ID (NCBI): 55676 RRID: AB_2254797 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6NXT4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924