Iright
BRAND / VENDOR: Proteintech

Proteintech, 13531-1-AP, Proenkephalin-A Polyclonal antibody

CATALOG NUMBER: 13531-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Proenkephalin-A (13531-1-AP) by Proteintech is a Polyclonal antibody targeting Proenkephalin-A in IHC, ELISA applications with reactivity to human samples 13531-1-AP targets Proenkephalin-A in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Proenkephalin-A(PENK) is also named asSynenkephalin,Met-enkephalinand Opioid growth factor (OGF), andbelongs to theopioid neuropeptide precursorfamily. PENK is a neuropeptide that competes with and mimics the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress(PMID:7057924). PENK hypermethylation is also associated with bladder cancer, hepatocellular carcinoma, colorectal cancer, and prostate cancer (PMID:36403035). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4428 Product name: Recombinant human PENK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-267 aa of BC032505 Sequence: MARFLTLCTWLLLLGPGLLATVRAECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQLSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRF Predict reactive species Full Name: proenkephalin Calculated Molecular Weight: 267 aa, 31 kDa GenBank Accession Number: BC032505 Gene Symbol: Proenkephalin A Gene ID (NCBI): 5179 RRID: AB_2161510 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01210 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924