Proteintech, 13566-1-AP, FCER1G Polyclonal antibody

Size: 20ul / 150ul The FCER1G (13566-1-AP) by Proteintech is a Polyclonal antibody targeting FCER1G in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 13566-1-AP targets FCER1G in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: RAW 264.7 cells, THP-1 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information FCER1G (Fc receptor gamma-chain, FcRgamma), also known as Fc-epsilon RI-gamma, or IgE Fc receptor subunit gamma (FceRI gamma), is a component of the high-affinity immunoglobulin E (IgE) receptor (Fc epsilon RI) which is a tetrameric complex of one alpha subunit, one beta subunit, and two disulfide-linked gamma subunits (PMID: 2146219; 2531187). Fc epsilon RI is present exclusively on mast cells and basophils, mediating allergic inflammatory signaling (PMID: 17438574). FCER1G is widely expressed and contains an immunoreceptor tyrosine-based activation motif (ITAM) that transduces activation signals from various immunoreceptors (PMID: 19098920). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4442 Product name: Recombinant human FCER1G protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-87 aa of BC033872 Sequence: MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKVIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ Predict reactive species Full Name: Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide Calculated Molecular Weight: 87 aa, 10 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC033872 Gene Symbol: FcRγ Gene ID (NCBI): 2207 RRID: AB_3669165 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P30273 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.