Iright
BRAND / VENDOR: Proteintech

Proteintech, 13595-1-AP, Tenascin-X Polyclonal antibody

CATALOG NUMBER: 13595-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Tenascin-X (13595-1-AP) by Proteintech is a Polyclonal antibody targeting Tenascin-X in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 13595-1-AP targets Tenascin-X in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, HT-1080 cells, rat liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human kidney tissue, human heart tissue, human lung tissue, human breast cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Tenascin-X (TNXB) is an extracellular matrix glycoprotein predominantly located in the outer reticular lamina of the basement membrane (BM) (PMID: 23768946). It interacts with many other ECM proteins and it accelerates collagen fibrillogenesis in vitro. TNXB plays a role in interactions between cell and ECM, antiadhesive effect, inhibiting cell migration, and in maintaining homeostasis of the extracellular matrix. Deficiency of TNXB has been associated with the connective tissue disorder Ehlers-Danlos syndrome. This antibody is raised against human TNXB and detects a band of about 75 kDa, which probably represents a proteolytic cleaved form of human TNXB (PMID: 17263730). But the serum form of tenascin-X is a 140-kD protein probably resulting from proteolytic cleavage or alternative splicing of tenascin-X(PMID: 16567571, 11642233). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4501 Product name: Recombinant human TNXB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 321-673 aa of BC033740 Sequence: PGSAVDYPLHDLVLHTNYTATVRGLRGPNLTSPASITFTTGLEAPRDLEAKEVTPRTALLTWTEPPVRPAGYLLSFHTPGGQNQEILLPGGITSHQLLGLFPSTSYNARLQAMWGQSLLPPVSTSFTTGGLRIPFPRDCGEEMQNGAGASRTSTIFLNGNRERPLNVFCDMETDGGGWLVFQRRMDGQTDFWRDWEDYAHGFGNISGEFWLGNEALHSLTQAGDYSMRVDLRAGDEAVFAQYDSFHVDSAAEYYRLHLEGYHGTAGDSMSYHSGSVFSARDRDPNSLLISCAVSYRGAWWYRNCHYANLNGLYGSTVDHQGVSWYHWKGFEFSVPFTEMKLRPRNFRSPAGGG Predict reactive species Full Name: tenascin XB Calculated Molecular Weight: 4289 aa, 464 kDa Observed Molecular Weight: 75 kDa, 140 kDa GenBank Accession Number: BC033740 Gene Symbol: TNXB Gene ID (NCBI): 7148 RRID: AB_10644124 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P22105 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924