Iright
BRAND / VENDOR: Proteintech

Proteintech, 13600-1-AP, LSAMP Polyclonal antibody

CATALOG NUMBER: 13600-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LSAMP (13600-1-AP) by Proteintech is a Polyclonal antibody targeting LSAMP in WB, ELISA applications with reactivity to human, mouse, rat samples 13600-1-AP targets LSAMP in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information LSAMP, also known as LAMP, is a 64-68 kDa heavily glycosylated neural cell adhesion molecule expressed on the neuronal dendrites and somata (PMID: 1688937; 8666243). LSAMP is a member of the IgLON family. The amino acid sequence of LSAMP is highly conserved among species. Human LSAMP shares 99% amino acid sequence identity with rodent LSAMP. The impact of LSAMP protein on neurite outgrowth and neuronal connectivity has been established in a wide spectrum of psychiatric disorders in humans (PMID: 26136648). In mice, lack of LSAMP protein seemingly leads to a deterioration in the ability to adapt to novel stressful environments and stimuli (PMID: 22155487). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4542 Product name: Recombinant human LSAMP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 34-322 aa of BC033803 Sequence: FNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGINGSISLAV Predict reactive species Full Name: limbic system-associated membrane protein Calculated Molecular Weight: 338 aa, 37 kDa Observed Molecular Weight: 64-68 kDa GenBank Accession Number: BC033803 Gene Symbol: LSAMP Gene ID (NCBI): 4045 RRID: AB_10597712 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13449 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924