Iright
BRAND / VENDOR: Proteintech

Proteintech, 13617-1-AP, RASGEF1B Polyclonal antibody

CATALOG NUMBER: 13617-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RASGEF1B (13617-1-AP) by Proteintech is a Polyclonal antibody targeting RASGEF1B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13617-1-AP targets RASGEF1B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue, mouse lung tissue, mouse ovary tissue Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information RASGEF1B is a guanine-nucleotide exchange factor, whose expression is induced inmacrophages on stimulation by TLR2 and TLR4 agonists. It interacts with Ras family proteins. It also interacts with CCDC124 during cytokinesis. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4525 Product name: Recombinant human RASGEF1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-210 aa of BC036784 Sequence: MPQTPPFSAMFDSSGYNRNLYQSAEDSCGGLYYHDNNLLSGSLEALIQHLVPNVDYYPDRTYIFTFLLSSRLFMHPYELMAKVCHLCVEHQRLSDPDSDKNQMRKIAPKILQLLTEWTETFPYDFRDERMMRNLKDLAHRIASGEEVGNLNLARLLEFPGRAWVGNGAELCILISTASSLFCLWASPPHHILVYLVCQVRMIIPSHFKGI Predict reactive species Full Name: RasGEF domain family, member 1B Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC036784 Gene Symbol: RASGEF1B Gene ID (NCBI): 153020 RRID: AB_10644147 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q0VAM2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924