Iright
BRAND / VENDOR: Proteintech

Proteintech, 13625-1-AP, GMFG Polyclonal antibody

CATALOG NUMBER: 13625-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GMFG (13625-1-AP) by Proteintech is a Polyclonal antibody targeting GMFG in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 13625-1-AP targets GMFG in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue, human heart tissue, human placenta tissue, mouse placenta tissue Positive IP detected in: mouse spleen tissue Positive IHC detected in: human lung cancer tissue, human kidney tissue, human placenta tissue, human testis tissue, human spleen tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GMFG, is a highly conserved brain-specific protein that belongs to the GMF subfamily of the larger Actin-binding protein ADF family. GMFG is preferentially expressed in blood vessel cells and immune cells and its ectopic expression enhances cellular functions such as tube-formation and migration in vitro. GMFG mediates neutrophil and T-lymphocyte migration via regulation of actin cytoskeletal reorganization. GMFG also acts as an intracellular regulator of stress-activated signal transduction by demonstrating activation of p38 MAP kinase and transcription factor NF-kB in astrocytes. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4538 Product name: Recombinant human GMFG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-141 aa of BC032819 Sequence: SDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR Predict reactive species Full Name: glia maturation factor, gamma Calculated Molecular Weight: 141 aa, 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC032819 Gene Symbol: GMFG Gene ID (NCBI): 9535 RRID: AB_2110929 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60234 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924