Iright
BRAND / VENDOR: Proteintech

Proteintech, 13636-1-AP, SLC12A1/NKCC2 Polyclonal antibody

CATALOG NUMBER: 13636-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC12A1/NKCC2 (13636-1-AP) by Proteintech is a Polyclonal antibody targeting SLC12A1/NKCC2 in WB, ELISA applications with reactivity to mouse samples 13636-1-AP targets SLC12A1/NKCC2 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4564 Product name: Recombinant human SLC12A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-176 aa of BC040138 Sequence: MSLNNSSNVFLDSVPSNTNRFQVSVINENHESSAAADDNTDPPHYEETSFGDEAQKRLRISFRPGNQECYDNFLQSGETAKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSISGPKVNRPSLLEIHEQLAKNVAVTPSSADRVANGDGIPGDEQAENKEDDQAGVVK Predict reactive species Full Name: solute carrier family 12 (sodium/potassium/chloride transporters), member 1 Calculated Molecular Weight: 121 kDa Observed Molecular Weight: 140-180 kDa GenBank Accession Number: BC040138 Gene Symbol: SLC12A1/NKCC2 Gene ID (NCBI): 6557 RRID: AB_3085420 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13621 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924