Proteintech, 13657-1-AP, SLC35A2 Polyclonal antibody

Size: 20ul / 150ul The SLC35A2 (13657-1-AP) by Proteintech is a Polyclonal antibody targeting SLC35A2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13657-1-AP targets SLC35A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse brain tissue Positive IHC detected in: human liver cancer tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4524 Product name: Recombinant human SLC35A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-242 aa of BC035747 Sequence: MAAVGAGGSTAAPGPGAVSAGALEPGTASAAHRRLKYISLAVLVVQNASLILSIRYARTLPGDRFFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQPSPRCSQSHSLCLCLRLRALRSPAASRAATTTAAVFPPWRPHHGALSAKVSAGEVRAGSNGGTQGRGTGVEGVGHLQDPSRHPPGPGSSGFGRWSFLPGH Predict reactive species Full Name: solute carrier family 35 (UDP-galactose transporter), member A2 Calculated Molecular Weight: 396 aa, 41 kDa Observed Molecular Weight: 41 kDa, 32 kDa GenBank Accession Number: BC035747 Gene Symbol: SLC35A2 Gene ID (NCBI): 7355 RRID: AB_2877967 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P78381 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.