Iright
BRAND / VENDOR: Proteintech

Proteintech, 13661-1-AP, CRMP4 Polyclonal antibody

CATALOG NUMBER: 13661-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CRMP4 (13661-1-AP) by Proteintech is a Polyclonal antibody targeting CRMP4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13661-1-AP targets CRMP4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: human colon tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information DPYSL3(Dihydropyrimidinase-related protein 3) is also named as CRMP4, DRP3, ULIP, ULIP1 and belongs to the hydantoinase/dihydropyrimidinase subfamily.DPYSL3 is a developmentally regulated protein, strongly expressed in early embryonic post-mitotic neural cells, reaching a peak of expression around the first post-natal week. In the adult brain, DPYSL3 is present mainly in regions that retain neurogenesis.DPYSL3 protein is also found in synaptic sites at the adult neuromuscular junction where it may be involved in the maintenance of neuronal stability(PMID: 16135096).It has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4557 Product name: Recombinant human DPYSL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 221-570 aa of BC039006 Sequence: EGHVLSRPEELEAEAVFRAITIASQTNCPLYVTKVMSKSAADLISQARKKGNVVFGEPITASLGIDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYINSLLASGDLQLSGSAHCTFSTAQKAIGKDNFTAIPEGTNGVEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRISVGSDSDLVIWDPDAVKIVSAKNHQSAAEYNIFEGMELRGAPLVVICQGKIMLEDGNLHVTQGAGRFIPCSPFSDYVYKRIKARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSGTQVDEGVRSASKRIVAPPGGRSNITSLS Predict reactive species Full Name: dihydropyrimidinase-like 3 Calculated Molecular Weight: 570 aa, 62 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC039006 Gene Symbol: CRMP4 Gene ID (NCBI): 1809 RRID: AB_10638641 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14195 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924