Iright
BRAND / VENDOR: Proteintech

Proteintech, 13671-1-AP, GALNT6 Polyclonal antibody

CATALOG NUMBER: 13671-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GALNT6 (13671-1-AP) by Proteintech is a Polyclonal antibody targeting GALNT6 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 13671-1-AP targets GALNT6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, MCF-7 cells, T-47D cells Positive IHC detected in: human lung squamous cell cancer, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information GALNT6 (polypeptide N-acetylgalactosaminyltransferase 6, GalNAc-T6), which is involved in the initiation of O-glycosylation, has been reported to play crucial roles in mammary carcinogenesis through binding to several substrates (PMID: 32393740). GALNT6 is upregulated in breast, ovarian, renal cell, lung and pancreatic cancers (PMID: 20215525). Overexpression of GRP78 could enhance Golgi-to-ER relocation of GALNT6 (PMID: 28110670). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4652 Product name: Recombinant human GALNT6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 323-622 aa of BC035822 Sequence: FDWSLTFGWETLPPHEKQRRKDETYPIKSPTFAGGLFSISKSYFEHIGTYDNQMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKGTSVIARNQVRLAEVWMDSYKKIFYRRNLQAAKMAQEKSFGDISERLQLREQLHCHNFSWYLHNVYPEMFVPDLTPTFYGAIKNLGTNQCLDVGENNRGGKPLIMYSCHGLGGNQYFEYTTQRDLRHNIAKQLCLHVSKGALGLGSCHFTGKNSQVPKDEEWELAQDQLIRNSGSGTCLTSQDKKPAMAPCNPSDPHQLWLFV Predict reactive species Full Name: UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 6 (GalNAc-T6) Calculated Molecular Weight: 622 aa, 71 kDa Observed Molecular Weight: 71 kDa GenBank Accession Number: BC035822 Gene Symbol: GALNT6 Gene ID (NCBI): 11226 RRID: AB_3669168 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NCL4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924