Proteintech, 13686-1-AP, PGK2 Polyclonal antibody

Size: 20ul / 150ul The PGK2 (13686-1-AP) by Proteintech is a Polyclonal antibody targeting PGK2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 13686-1-AP targets PGK2 in WB, IHC, IF-P, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue, HeLa cells, HepG2 cells, human heart tissue, human testis tissue, mouse brain tissue Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information PGK2, phosphoglycerate kinase 2, which belongs to the phosphoglycerate kinase superfamily. It catalyzes the first ATP-generating step in the central metabolic pathway of glycolysis, converting 1,3-bisphosphoglycerate and ADP to 3-phosphoglycerate and ATP. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4553 Product name: Recombinant human PGK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 242-360 aa of BC038843 Sequence: YTFLKVLNNMEIGASLFDEEGAKIVKDIMAKAQKNGVRITFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGPLGVFEWDAFAKGTKALMDEIV Predict reactive species Full Name: phosphoglycerate kinase 2 Calculated Molecular Weight: 417 aa, 45 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC038843 Gene Symbol: PGK2 Gene ID (NCBI): 5232 RRID: AB_2161237 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P07205 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.