Iright
BRAND / VENDOR: Proteintech

Proteintech, 13687-1-AP, VEGFR-1/FLT-1 Polyclonal antibody

CATALOG NUMBER: 13687-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The VEGFR-1/FLT-1 (13687-1-AP) by Proteintech is a Polyclonal antibody targeting VEGFR-1/FLT-1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 13687-1-AP targets VEGFR-1/FLT-1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, human placenta tissue, mouse lung tissue Positive IP detected in: A549 cells Positive IHC detected in: human renal cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information Vascular endothelial growth factor receptor-1 (VEGFR-1, FLT-1) is a receptor tyrosine kinase belonging to the VEGFR family. VEGF is a key regulator of physiological angiogenesis and has also been implicated in pathological angiogenesis associated with tumors, intraocular neovascular disorders, and other conditions. The biological effects of VEGF are mediated by VEGFR-1 and VEGFR-2. Both the two receptors have seven immunoglobulin-like repeats in the extracellular domain, a single transmembrane region and a tyrosine kinase domain. VEGFR-1 binds VEGFA, PIGF, and VEGFB, and plays an essential role in the development of embryonic vasculature, the regulation of angiogenesis, cell survival, cell migration, macrophage function, chemotaxis, and cancer cell invasion. Two isoforms of VEGFR-1 exist, a full-length transmembrane form and a short soluble form (sVEGFR-1) consisting of only the extracellular ligand-binding domain. (PMID: 12778165; 17109193; 8806634) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, bovine, deer Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4558 Product name: Recombinant human VEGFR1, FLT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-300 aa of BC039007 Sequence: TGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK Predict reactive species Full Name: fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor) Calculated Molecular Weight: 1338 aa, 151 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC039007 Gene Symbol: VEGFR-1/FLT-1 Gene ID (NCBI): 2321 RRID: AB_10644337 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P17948 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924