Iright
BRAND / VENDOR: Proteintech

Proteintech, 13690-1-AP, NEDD4L Polyclonal antibody

CATALOG NUMBER: 13690-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NEDD4L (13690-1-AP) by Proteintech is a Polyclonal antibody targeting NEDD4L in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 13690-1-AP targets NEDD4L in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: C6 cells, HT-1080 cells, PC-3 cells, PC-12 cells Positive IP detected in: C6 cells Positive IHC detected in: human stomach cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information NEDD4L(E3 ubiquitin-protein ligase NEDD4-like) is also named as KIAA0439, NEDL3, Nedd4-2. It accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substratesand and is the principal ubiquitin ligase that selectively targets activated SMAD2 and SMAD3 for destruction (PMID:19917253). Nedd4L binds the PY motif of ENaC COOH terminals and catalyzes ubiquitination of the NH2 terminus of the protein for subsequent degradation (PMID:18268134). It has some isoforms produced by alternative splicing. This antibody may have cross reaction with NEDD4 due to the high homology of the antigen. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4565 Product name: Recombinant human NEDD4L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 565-911 aa of BC032597 Sequence: EESYRRIMSVKRPDVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFEGVD Predict reactive species Full Name: neural precursor cell expressed, developmentally down-regulated 4-like Calculated Molecular Weight: 854 aa, 96 kDa Observed Molecular Weight: 112 kDa, 125 kDa GenBank Accession Number: BC032597 Gene Symbol: NEDD4L Gene ID (NCBI): 23327 RRID: AB_2149326 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96PU5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924