Proteintech, 13703-1-AP, Calcyon Polyclonal antibody

Size: 20ul / 150ul The Calcyon (13703-1-AP) by Proteintech is a Polyclonal antibody targeting Calcyon in IHC, ELISA applications with reactivity to human samples 13703-1-AP targets Calcyon in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human pituitary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Calcyon, also named as NSG3, DRD1IP and CALY, is a neuron-specific vesicular protein. It localizes to dendritic spines of D1 receptor-expressing pyramidal cells in prefrontal cortex. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4622 Product name: Recombinant human CALCYON protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-217 aa of BC038978 Sequence: MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPDQQNFPDLEGQRLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLRHKICTPLTLEMYYTEMDPERHRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPTQAGAAAAATEPPGKPSAKAEKEAARKAAGSAAPPPAQ Predict reactive species Full Name: calcyon neuron-specific vesicular protein Calculated Molecular Weight: 217 aa, 23 kDa GenBank Accession Number: BC038978 Gene Symbol: Calcyon Gene ID (NCBI): 50632 RRID: AB_3085422 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NYX4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.