Proteintech, 13720-1-AP, BOULE Polyclonal antibody

Size: 20ul / 150ul The BOULE (13720-1-AP) by Proteintech is a Polyclonal antibody targeting BOULE in WB, IHC, IF-P, IF-Fro, IP, ELISA applications with reactivity to human, mouse, rat samples 13720-1-AP targets BOULE in WB, IHC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: mouse testis tissue, mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Positive IF-Fro detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800 Background Information BOULE, also called BOLL, belongs to the RRM DAZ family. BOULE has been identified as being involved in regulating the development and differentiation of germ cells and playing an essential role in infertility (PMID: 31683986). BOULE is specifically expressed in testis, but not in early embryos, primordial germ cells, and spermatogonial cells. It is first expressed in the cytoplasm of spermatocytes and then persists through meiosis. BOULE has 5 isoforms with the molecular mass of 19 and 31-38 kDa. This antibody detects two bands in testis, the lower band of ~40 kDa in size corresponds to the predicted endogenous BOULE protein, while the upper band may be an isoform or posttranslationally modified version of the BOULE protein (PMID: 27632217). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4662 Product name: Recombinant human BOLL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-283 aa of BC033674 Sequence: MQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPAYHYQATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY Predict reactive species Full Name: bol, boule-like (Drosophila) Calculated Molecular Weight: 283 aa, 31 kDa Observed Molecular Weight: 38-42 kDa GenBank Accession Number: BC033674 Gene Symbol: BOULE Gene ID (NCBI): 66037 RRID: AB_2290617 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N9W6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.