Iright
BRAND / VENDOR: Proteintech

Proteintech, 13739-1-AP, RACGAP1 Polyclonal antibody

CATALOG NUMBER: 13739-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RACGAP1 (13739-1-AP) by Proteintech is a Polyclonal antibody targeting RACGAP1 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 13739-1-AP targets RACGAP1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: K-562 cells, HeLa cells, RAW 264.7 cells, mouse testis tissue Positive IP detected in: mouse testis tissue, HeLa cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Rac GTPase-activating protein 1 (RACGAP1), localized in the mitotic spindle, has guanosine triphosphatase-activating protein (GAP) activity for the Rho family GTPases. RACGAP1 has an important influence on the initiation of cytokinesis, control of cell growth and differentiation, regulation of spermatogenesis, and tumor metastasis. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4676 Product name: Recombinant human RACGAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 334-632 aa of BC032754 Sequence: PCIPTLIGTPVKIGEGMLADFVSQTSPMIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKTVPLLSKVDDIHAICSLLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAMYQAVGELPQANRDTLAFLMIHLQRVAQSPHTKMDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQPKVVERLLSLPLEYWSQFMMVEQENIDPLHVIENSNAFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRSTLTKNTPRFGSKSKSATNLGRQGNFFASPMLK Predict reactive species Full Name: Rac GTPase activating protein 1 Calculated Molecular Weight: 632 aa, 71 kDa Observed Molecular Weight: 71 kDa GenBank Accession Number: BC032754 Gene Symbol: RACGAP1 Gene ID (NCBI): 29127 RRID: AB_2176276 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H0H5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924