Proteintech, 13740-1-AP, DUT Polyclonal antibody

Size: 20ul / 150ul The DUT (13740-1-AP) by Proteintech is a Polyclonal antibody targeting DUT in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 13740-1-AP targets DUT in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, human liver tissue, human kidney tissue, HEK-293 cells, Ramos cells, A549 cells, HepG2 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4677 Product name: Recombinant human DUT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-164 aa of BC033645 Sequence: MPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN Predict reactive species Full Name: deoxyuridine triphosphatase Calculated Molecular Weight: 252 aa, 27 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC033645 Gene Symbol: DUT Gene ID (NCBI): 1854 RRID: AB_2093170 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P33316 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.