Iright
BRAND / VENDOR: Proteintech

Proteintech, 13753-1-AP, RNASET2 Polyclonal antibody

CATALOG NUMBER: 13753-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RNASET2 (13753-1-AP) by Proteintech is a Polyclonal antibody targeting RNASET2 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13753-1-AP targets RNASET2 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: transfected cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information RNASET2(Ribonuclease T2) is also named as RNASE6PL(Ribonuclease 6) and belongs to the RNase T2 family. It is a unique member of the growing family of tumor-antagonizing genes and behaves as a class II tumor suppressor and abolish the tumorigenic potential of an ovarian cancer-derived cell line. This protein has 2 isoforms produced by alternative splicing. Both mildly glycosylated (ranging from38 to 45 kDa) and highly glycosylated forms (ranging from 50 to 80 kDa) of human tumor suppressor protein RNASET2 can be detected in immunoblotting in P. Pastoris(PMID: 21446958). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4695 Product name: Recombinant human RNASET2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-256 aa of BC039713 Sequence: DKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH Predict reactive species Full Name: ribonuclease T2 Calculated Molecular Weight: 256 aa, 29 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC039713 Gene Symbol: RNase T2 Gene ID (NCBI): 8635 RRID: AB_2285339 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00584 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924