Proteintech, 13787-1-AP, EAF1 Polyclonal antibody

Size: 20ul / 150ul The EAF1 (13787-1-AP) by Proteintech is a Polyclonal antibody targeting EAF1 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 13787-1-AP targets EAF1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, HeLa cells, mouse brain tissue Positive IP detected in: HeLa cells Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information ELL associated factor 1 and ELL associated factor 2 (EAF1/2 factors) are reported to play important roles in tumor suppression and embryogenesis. The tumor suppressor EAF2 is regulated by androgen signaling and associated with prostate cancer. Eaf factors have been revealed to modulate mesoderm and neural patterning by inhibiting canonical Wnt signaling, and high activity of canonical Wnt/β-catenin is revealed in eafs morphants (PMID: 23364330). Catalog#13787-1-AP is a rabbit polyclonal antibody raised against the full-length of human EAF1. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4804 Product name: Recombinant human EAF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-268 aa of BC041329 Sequence: MNGTANPLLDREEHCLRLGESFEKRPRASFHTIRYDFKPASIDTSCEGELQVGKGDEVTITLPHIPGSTPPMTVFKGNKRPYQKDCVLIINHDTGEFVLEKLSSSIQVKKTRAEGSSKIQARMEQQPTRPPQTSQPPPPPPPMPFRAPTKPPVGPKTSPLKDNPSPEPQLDDIKRELRAEVDIIEQMSSSSGSSSSDSESSSGSDDDSSSSGGEDNGPASPPQPSHQQPYNSRPAVANGTSRPQGSNQLMNALRNDLQLSESGSDSDD Predict reactive species Full Name: ELL associated factor 1 Calculated Molecular Weight: 268 aa, 29 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC041329 Gene Symbol: EAF1 Gene ID (NCBI): 85403 RRID: AB_2255402 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96JC9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.