Proteintech, 13789-1-AP, RAP2A Polyclonal antibody

Size: 20ul / 150ul The RAP2A (13789-1-AP) by Proteintech is a Polyclonal antibody targeting RAP2A in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 13789-1-AP targets RAP2A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, mouse lung tissue, K-562 cells, mouse brain tissue, PC-3 cells, HeLa cells Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4808 Product name: Recombinant human RAP2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-183 aa of BC041333 Sequence: MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ Predict reactive species Full Name: RAP2A, member of RAS oncogene family Calculated Molecular Weight: 183 aa, 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC041333 Gene Symbol: RAP2A Gene ID (NCBI): 5911 RRID: AB_2177303 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10114 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.