Proteintech, 13796-1-AP, WBSCR16 Polyclonal antibody

Size: 20ul / 150ul The WBSCR16 (13796-1-AP) by Proteintech is a Polyclonal antibody targeting WBSCR16 in WB, ELISA applications with reactivity to human samples 13796-1-AP targets WBSCR16 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4619 Product name: Recombinant human WBSCR16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC032712 Sequence: MALVALVAGARLGRRLSGPGLGRGHWTAAGRSRSRREAAEAEAEVPVVQYVGERAARADRVFVWGFSFSGALGVPSFVVPSSGPGPRAGARPRRRIQPVPYRLELDQKISSAACGYGFTLLSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLPLDRPQETRVLQVSCGRAHSLVLTDREGVFSMGNNSYGQCGRKVVENEIYSESHRVHRMQDFDGQVVQVACGQDHSLFLTDKGEVYSCGWGADGQTGLGHYNITSSPTKLGGDLAGVNVIQVATYGDCCLAVSADGGLFGWGNSEYLQLASVTDSTQVNVPRCLHFSGVGKVRQAACGGTGCAV Predict reactive species Full Name: Williams-Beuren syndrome chromosome region 16 Calculated Molecular Weight: 464 aa, 50 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC032712 Gene Symbol: WBSCR16 Gene ID (NCBI): 81554 RRID: AB_2214934 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96I51 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.