Proteintech, 13802-1-AP, CORO2B Polyclonal antibody

Size: 20ul / 150ul The CORO2B (13802-1-AP) by Proteintech is a Polyclonal antibody targeting CORO2B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13802-1-AP targets CORO2B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, mouse brain tissue Positive IHC detected in: human ovary cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:800-1:3200 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4793 Product name: Recombinant human CORO2B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-331 aa of BC026335 Sequence: MSWRPQYRSSKFRNVYGKVANREHCFDGIPITKNVHDNHFCAVNTRFLAIVTESAGGGSFLVIPLEQTGRIEPNYPKVCGHQGNVLDIKWNPFIDNIIASCSEDTSVRIWEIPEGGLKRNMTEALLELHGHSRRVGLVEWHPTTNNILFSAGYDYKVLIWNLDVGEPVKMIDCHTDVILCMSFNTDGSLLTTTCKDKKLRVIEPRSGRVLQEANCKNHRVNRVVFLGNMKRLVTTGVSRWNTRQIALWDQEDLSMPLIEEEIDGLSGLLFPFYDADTHMLYLAGKGDGNIRYYEISTEKPYLSYLMEFRSPAPQKGLGVMPKHGLDVSACE Predict reactive species Full Name: coronin, actin binding protein, 2B Calculated Molecular Weight: 475 aa, 54 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC026335 Gene Symbol: CORO2B Gene ID (NCBI): 10391 RRID: AB_2087042 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UQ03 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.