Iright
BRAND / VENDOR: Proteintech

Proteintech, 13806-1-AP, TSSK2 Polyclonal antibody

CATALOG NUMBER: 13806-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TSSK2 (13806-1-AP) by Proteintech is a Polyclonal antibody targeting TSSK2 in WB, ELISA applications with reactivity to human samples 13806-1-AP targets TSSK2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Background Information TSSK2 (Testis-Specific Serine/Threonine Kinase 2) is a member of the TSSK family, predominantly expressed in the testis and involved in spermiogenesis and male fertility. It is localized in various regions of sperm, including the centrioles of post-meiotic spermatids, the tail, acrosomal regions, and the midpiece. TSSK2 plays a crucial role in sperm maturation by phosphorylating substrates such as TSKS and SPAG16L. Studies have shown that TSSK2 knockout mice exhibit infertility due to impaired spermatid elongation and sperm maturation. Additionally, TSSK2 is considered a promising target for reversible male contraception, with several potent inhibitors identified through high-throughput screening. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4805 Product name: Recombinant human TSSK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-198 aa of BC037781 Sequence: MDDATVLRKKGYIVGINLGKGSYAKVKSAYSERLKFNVAVKIIDRKKTPTDFVERFLPREMDILATVNHGSIIKTYEIFETSDGRIYIIMELGVQGDLLEFIKCQGALHEDVARKMFRQLSSAVKYCHDLDIVHRDLKCENLLLDKDFNIKLSDFGFSKRCLRDSNGRIILSKTFCGSAAYAAPEVLQSIPYQPKVYD Predict reactive species Full Name: testis-specific serine kinase 2 Calculated Molecular Weight: 358 aa, 41 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC037781 Gene Symbol: TSSK2 Gene ID (NCBI): 23617 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96PF2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924