Iright
BRAND / VENDOR: Proteintech

Proteintech, 13831-1-AP, GLRA2 Polyclonal antibody

CATALOG NUMBER: 13831-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GLRA2 (13831-1-AP) by Proteintech is a Polyclonal antibody targeting GLRA2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13831-1-AP targets GLRA2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PBMC cells, K-562 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Glycine is an inhibitory neurotransmitter in the central nervous system. The glycine receptor (GlyR) is a member of the nicotinic acetylcholine receptor of ligand-gated ion channels. This receptor has important roles in a variety of physiological processes, especially in mediating inhibitory neurotransmission in the spinal cord and brain stem. GlyR is a pentameric receptor comprised of alpha and beta subunits. Four alpha-subunits (GLRA1, GLRA2, GLRA3, GLRA4) and one beta-subunit (GLRB) of GlyR have been identified. (PMID: 11409700; 15383648) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4743 Product name: Recombinant human GLRA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-255 aa of BC032864 Sequence: MNRQLVNILTALFAFFLETNHFRTAFCKDHDSRSGKQPSQTLSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYCTKHYNTGKFTCIEVKFHLERQMG Predict reactive species Full Name: glycine receptor, alpha 2 Calculated Molecular Weight: 452 aa, 52 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC032864 Gene Symbol: GLRA2 Gene ID (NCBI): 2742 RRID: AB_2877980 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P23416 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924