Iright
BRAND / VENDOR: Proteintech

Proteintech, 13848-1-AP, SLC2A13 Polyclonal antibody

CATALOG NUMBER: 13848-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC2A13 (13848-1-AP) by Proteintech is a Polyclonal antibody targeting SLC2A13 in WB, ELISA applications with reactivity to human, mouse, pig samples 13848-1-AP targets SLC2A13 in WB, ELISA applications and shows reactivity with human, mouse, pig samples. Tested Applications Positive WB detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information HMIT is a glycosylated protein containing three conserved internalization signals: an ER retention signal and a dileucine internalization signal in the N-terminal region and a tyrosine-based internalization motif at the C-terminus. Specification Tested Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4818 Product name: Recombinant human SLC2A13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 243-338 aa of BC047507 Sequence: SPRWLIQKGQTQKARRILSQMRGNQTIDEEYDSIKNNIEEEEKEVGSAGPVICRMLSYPPTRRALIVGCGLQMFQQLSGINTIMYVFLSGFLLKRL Predict reactive species Full Name: solute carrier family 2 (facilitated glucose transporter), member 13 Calculated Molecular Weight: 629 aa, 70 kDa Observed Molecular Weight: 75~90 kDa GenBank Accession Number: BC047507 Gene Symbol: SLC2A13 Gene ID (NCBI): 114134 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96QE2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924