Iright
BRAND / VENDOR: Proteintech

Proteintech, 13861-1-AP, CCPG1 Polyclonal antibody

CATALOG NUMBER: 13861-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CCPG1 (13861-1-AP) by Proteintech is a Polyclonal antibody targeting CCPG1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 13861-1-AP targets CCPG1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, L02 cells, THP-1 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Cell-cycle progression gene 1 (CCPG1) is a receptor for ER stress-induced ER-phagy. CCPG1 localizes to perinuclear ER and in small foci at the ER periphery. It contains a LIR at the N-terminal cytosolic domain engaging LC3/GABARAP. (PMID: 29802216, PMID: 29290589) Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4841 Product name: Recombinant human CCPG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 264-613 aa of BC034914 Sequence: LHGKSDSPNVYTEKKEIAILRERLTELELKLTFEQQRSDLWERLYVEAKDQNGKQGTDGKKKGGRGSHRAKNKSKETFLGSVKETFDAMKNSTKEFVRHHKEKIKQAKEAVKENLKKFSDSVKSTFRHFKDTTKNIFDEKGNKRFGATKEAAEKPRTVFSDYLHPQYKAPTENHHNRGPTMQNDGRKEKPVHFKEFRKNTNSKKCSPGHDCRENSHSFREACSGVFDCAQQESMSLFNIVVNPIRMDEFRQIIQRYMLKELDTFCHWNELDQFINKFFLNGVFIHDQKLFTDFVNDVKDYLRNMKEYEVDNDGVFEKLDEYIYRHFFGHTFSPPYGPRSVYIKPCHYSSL Predict reactive species Full Name: cell cycle progression 1 Calculated Molecular Weight: 87 kDa Observed Molecular Weight: 110 kDa GenBank Accession Number: BC034914 Gene Symbol: CCPG1 Gene ID (NCBI): 9236 RRID: AB_2074010 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9ULG6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924