Iright
BRAND / VENDOR: Proteintech

Proteintech, 13888-1-AP, NKIAMRE Polyclonal antibody

CATALOG NUMBER: 13888-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NKIAMRE (13888-1-AP) by Proteintech is a Polyclonal antibody targeting NKIAMRE in WB, IHC, ELISA applications with reactivity to human samples 13888-1-AP targets NKIAMRE in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NKIAMRE is also named as CDKL3(Cyclin-dependent kinase-like 3) and belongs to the protein kinase superfamily.This protein contains the MAPK-like TDY motif for threonine and tyrosine phosphorylation, as well as the putative cyclin-binding motif(PMID:10463609). It has 2 isoforms produced by alternative splicing with the molecular mass of 52 kDa and 68 kDa. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4812 Product name: Recombinant human CDKL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-279 aa of BC041799 Sequence: MEMYETLGKVGEGSYGTVMKCKHKNTGQIVAIKIFYERPEQSVNKIAMREIKFLKQFHHENLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHGLESKRLRKYLFQILRAIDYLHSNNIIHRDIKPENILVSQSGITKLCDFGFARTLAAPGDIYTDYVATRWYRAPELVLKDTSYGKPVDIWALGCMIIEMATGNPYLPSSSDLDLLHKIVLKVGNLSPHLQNIFSKSPIFAGVVLPQVQHPKNARKKYPKLNGLLADIVHACLQIDPADRISSSD Predict reactive species Full Name: cyclin-dependent kinase-like 3 Calculated Molecular Weight: 592 aa, 68 kDa Observed Molecular Weight: 52-60 kDa GenBank Accession Number: BC041799 Gene Symbol: NKIAMRE Gene ID (NCBI): 51265 RRID: AB_2077463 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IVW4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924