Proteintech, 13893-1-AP, Synaptojanin 2 Polyclonal antibody

Size: 20ul / 150ul The Synaptojanin 2 (13893-1-AP) by Proteintech is a Polyclonal antibody targeting Synaptojanin 2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13893-1-AP targets Synaptojanin 2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells Positive IHC detected in: human brain tissue, mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SYNJ2(Synaptojanin-2) is also named as KIAA0348 and belongs to the synaptojanin family. SYNJ2 encodes an inositol polyphosphate phosphatase that functions in recycling neurotransmitter vesicles and is implicated in spermatogenesis(PMID: 24103750). This protein has 3 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4855 Product name: Recombinant human SYNJ2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1147-1496 aa of BC043277 Sequence: APQQPPKARTGISKPYNVKQIKTTNAQEAEAAIRCLLEARGGASEEALSAVAPRDLEASSEPEPTPGAAKPETPQAPPLLPRRPPPRVPAIKKPTLRRTGKPLSPEEQFEQQTVHFTIGPPETSVEAPPVVTAPRVPPVPKPRTFQPGKAAERPSHRKPASDEAPPGAGASVPPPLEAPPLVPKVPPRRKKSAPAAFHLQVLQSNSQLLQGLTYNSSDSPSGHPPAAGTVFPQGDFLSTSSATSPDSDGTKAMKPEAAPLLGDYQDPFWNLLHHPKLLNNTWLSKSSDPLDSGTRSPKRDPIDPVSAGASAAKAELPPDHGHKTLGHWVTISDQEKRTALQVFDPLAKT Predict reactive species Full Name: synaptojanin 2 Calculated Molecular Weight: 1496 aa, 166 kDa Observed Molecular Weight: 143, 160 kDa GenBank Accession Number: BC043277 Gene Symbol: SYNJ2 Gene ID (NCBI): 8871 RRID: AB_2255784 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15056 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.