Proteintech, 13900-1-AP, DHDH Polyclonal antibody

Size: 20ul / 150ul The DHDH (13900-1-AP) by Proteintech is a Polyclonal antibody targeting DHDH in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13900-1-AP targets DHDH in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2400 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4866 Product name: Recombinant human DHDH protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-334 aa of BC032730 Sequence: MALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSVEVAYIGTQHPQHKAAVMLCLAAGKAVLCEKPTGVNAAEVREMVAEARSRALFLMEAIWTRFFPASEALRSVLAQGTLGDLRVARAEFGKNLIHVPRAVDRAQAGGALLDIGIYCVQFTSMVFGGQKPEKISVVGRRHETGVDDTVTVLLQYPGEVHGSFTCSITVQLSNTASVSGTKGMVQLLNPCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMKESPVIPLSESELLADILEEVRKAIGVTFPQDKR Predict reactive species Full Name: dihydrodiol dehydrogenase (dimeric) Calculated Molecular Weight: 334 aa, 36 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: BC032730 Gene Symbol: DHDH Gene ID (NCBI): 27294 RRID: AB_2292833 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UQ10 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.