Iright
BRAND / VENDOR: Proteintech

Proteintech, 13936-1-AP, SMCP Polyclonal antibody

CATALOG NUMBER: 13936-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SMCP (13936-1-AP) by Proteintech is a Polyclonal antibody targeting SMCP in WB, ELISA applications with reactivity to human samples 13936-1-AP targets SMCP in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information SMCP, also named as MCS and MCSP, is a cysteine- and proline-rich structural protein that is closely associated with the keratinous capsules of sperm mitochondria in the mitochondrial sheath surrounding the outer dense fibers and axoneme. It is involved in sperm motility. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4984 Product name: Recombinant human SMCP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC014593 Sequence: MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK Predict reactive species Full Name: sperm mitochondria-associated cysteine-rich protein Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 12-25 kDa GenBank Accession Number: BC014593 Gene Symbol: SMCP Gene ID (NCBI): 4184 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49901 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924