Iright
BRAND / VENDOR: Proteintech

Proteintech, 13947-1-AP, GPX3 Polyclonal antibody

CATALOG NUMBER: 13947-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GPX3 (13947-1-AP) by Proteintech is a Polyclonal antibody targeting GPX3 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 13947-1-AP targets GPX3 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, rat kidney tissue Positive IHC detected in: rat eye tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse kidney tissue Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information GPX3 (glutathione peroxidase 3) is also named as Plasma Glutathione Peroxidase. GPX3 can protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. GPX3 is secreted into plasma and like GPX1, is an 100 kDa homotetramer consisting of four identical 23 kDa subunits, each containing a selenocysteine residue at the active site. It can be detected a band of 20 kDa which is considered as the chain A of GPX3 (selenocysteine to glycine mutant). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5054 Product name: Recombinant human GPX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC050378 Sequence: MARLLQASCLLSLLLAGFVSQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASY Predict reactive species Full Name: glutathione peroxidase 3 (plasma) Calculated Molecular Weight: 226 aa, 26 kDa Observed Molecular Weight: 20-27 kDa GenBank Accession Number: BC050378 Gene Symbol: GPX3 Gene ID (NCBI): 2878 RRID: AB_3085426 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P22352 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924