Proteintech, 14013-1-AP, RARB Polyclonal antibody

Size: 20ul / 150ul The RARB (14013-1-AP) by Proteintech is a Polyclonal antibody targeting RARB in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 14013-1-AP targets RARB in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Sp2/0 cells Positive IHC detected in: mouse colon tissue, mouse bladder tissue, human pancreas cancer tissue, human renal cell carcinoma tissue, mouse brain tissue, rat bladder tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Retinoic acid receptors (RARs) are important mediators of retinoid signaling in morphogenesis, development, and cell differentiation. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes (PMID:12554770). They can bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In the absence or presence of hormone ligand, they act mainly as activators of gene expression due to weak binding to corepressors. RARB is one isotypes of RARs (PMID:12834868). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5119 Product name: Recombinant human RARB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 99-448 aa of BC060794 Sequence: EGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ Predict reactive species Full Name: retinoic acid receptor, beta Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 37-51 kDa GenBank Accession Number: BC060794 Gene Symbol: RARB Gene ID (NCBI): 5915 RRID: AB_2177765 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10826 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.