Iright
BRAND / VENDOR: Proteintech

Proteintech, 14037-1-AP, FEM1C Polyclonal antibody

CATALOG NUMBER: 14037-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FEM1C (14037-1-AP) by Proteintech is a Polyclonal antibody targeting FEM1C in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 14037-1-AP targets FEM1C in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse heart tissue, HepG2 cells, rat brain tissue Positive IHC detected in: human heart tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Protein fem-1 homolog C (FEM1C) is involved in protein modification and ubiquitination.Probable component of an E3 ubiquitin-protein ligase complex, in which it may act as a substrate recognition subunit.Highly expressed in kidney, cardiac tissue, skeletal muscle and testis. Expressed at lower levels in other tissues, including cartilage.This antibody specifically recognizes the 69kd FEM1C protein. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5099 Product name: Recombinant human FEM1C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 315-617 aa of BC028369 Sequence: PDEMRMQALLIRERILGPSHPDTSYYIRYRGAVYADSGNFKRCINLWKYALDMQQSNLDPLSPMTASSLLSFAELFSFMLQDRAKGLLGTTVTFDDLMGILCKSVLEIERAIKQTQCPADPLQLNKALSIILHLICLLEKVPCTLEQDHFKKQTIYRFLKLHPRGKNNFSPLHLAVDKNTTCVGRYPVCKFPSLQVTAILIECGADVNVRDSDDNSPLHIAALNNHPDIMNLLIKSGAHFDATNLHKQTASDLLDEKEIAKNLIQPINHTTLQCLAARVIVNHRIYYKGHIPEKLETFVSLHR Predict reactive species Full Name: fem-1 homolog c (C. elegans) Calculated Molecular Weight: 69 kDa Observed Molecular Weight: 69 kDa GenBank Accession Number: BC028369 Gene Symbol: FEM1C Gene ID (NCBI): 56929 RRID: AB_2878002 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96JP0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924