Proteintech, 14047-1-AP, GPR116 Polyclonal antibody

Size: 20ul / 150ul The GPR116 (14047-1-AP) by Proteintech is a Polyclonal antibody targeting GPR116 in WB, IHC, ELISA applications with reactivity to human samples 14047-1-AP targets GPR116 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, Y79 cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GPR116 (ADGRF5, adhesion G protein-coupled receptor F5) is involved in the G protein-coupled receptor signaling pathway and cell surface receptor signaling pathway. may act upstream of or within several processes, including glomerular filtration; pharyngeal arch artery morphogenesis; and surfactant homeostasis. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5214 Product name: Recombinant human GPR116 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 34-349 aa of BC066121 Sequence: LSLHEHEPAGEEALRQKRAVATKSPTAEEYTVNIEISFENASFLDPIKAYLNSLSFPIHGNNTDQITDILSINVTTVCRPAGNEIWCSCETGYGWPRERCLHNLICQERDVFLPGHHCSCLKELPPNGPFCLLQEDVTLNMRVRLNVGFQEDLMNTSSALYRSYKTDLETAFRKGYGILPGFKGVTVTGFKSGSVVVTYEVKTTPPSLELIHKANEQVVQSLNQTYKMDYNSFQAVTINESNFFVTPEIIFEGDTVSLVCEKEVLSSNVSWRYEEQQLEIQNSSRFSIYTALFNNMTSVSKLTIHNITPGDAGEYV Predict reactive species Full Name: G protein-coupled receptor 116 Calculated Molecular Weight: 1346 aa, 149 kDa Observed Molecular Weight: 149 kDa GenBank Accession Number: BC066121 Gene Symbol: GPR116 Gene ID (NCBI): 221395 RRID: AB_2113095 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IZF2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.