Iright
BRAND / VENDOR: Proteintech

Proteintech, 14048-1-AP, FATP2 Polyclonal antibody

CATALOG NUMBER: 14048-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FATP2 (14048-1-AP) by Proteintech is a Polyclonal antibody targeting FATP2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 14048-1-AP targets FATP2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse liver, rat kidney, rat liver, mouse liver tissue, rat liver tissue Positive IP detected in: HepG2 cells Positive IHC detected in: human liver cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information FATP2 is a member of the FATP family which functions in lipid and bile metabolism. It is a 70-kDa protein predominantly expressed in liver and kidney. Kidney FATP2 is localized exclusively to proximal tubule epithelial cells along the apical but not the basolateral membrane, and regulates lipoapoptosis. FATP2 is involved in metabolism-related diseases including nonalcoholic fatty liver disease (NAFLD) and type 2 diabetes mellitus (T2DM), and is a potential clinical biomarker and therapeutic target. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5217 Product name: Recombinant human SLC27A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 208-567 aa of BC057770 Sequence: ESWRSEVTFSTPALYIYTSGTTGATLALRTKFSASQFWDDCRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFVKRFGDICIYEFYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKGEVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDRVGDTFRWKGENVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHEFDGKKLFQHIADYLPSYARPRFLRIQDTIEITGTFKHRKMTLVEEGFNPAVIKDALYFLDDTAKMYVPMTEDIYNAISAKTLKL Predict reactive species Full Name: solute carrier family 27 (fatty acid transporter), member 2 Calculated Molecular Weight: 567 aa, 65 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC057770 Gene Symbol: FATP2/SLC27A2 Gene ID (NCBI): 11001 RRID: AB_2239416 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14975 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924