Iright
BRAND / VENDOR: Proteintech

Proteintech, 14065-1-AP, DAZ Polyclonal antibody

CATALOG NUMBER: 14065-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DAZ (14065-1-AP) by Proteintech is a Polyclonal antibody targeting DAZ in WB, ELISA applications with reactivity to human, rat samples 14065-1-AP targets DAZ in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: human testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information DAZ4, encoded by the DAZ gene, is an RNA-binding protein with a role in spermatogenesis. DAZ4 is a testis-specific protein that expression restricted to premeiotic germ cells, particularly in spermatogonia. Defects in DAZ4 may be a cause of spermatogenic failure Y-linked type 2 (SPGFY2). It is a disorder resulting in the absence (azoospermia) or reduction (oligozoospermia) of sperm in the semen, leading to male infertility. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5116 Product name: Recombinant human DAZ4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-343 aa of BC047617 Sequence: MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQAYSAYPHSPGQVITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQPFPAYPSSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAFPAYPNSPVQVTTGYQLPVYNYQAFPAYPNSA Predict reactive species Full Name: deleted in azoospermia 4 Calculated Molecular Weight: 65 kDa Observed Molecular Weight: 60-65 kDa GenBank Accession Number: BC047617 Gene Symbol: DAZ4 Gene ID (NCBI): 57135 RRID: AB_2878008 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86SG3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924