Iright
BRAND / VENDOR: Proteintech

Proteintech, 14079-1-AP, KCNA3 Polyclonal antibody

CATALOG NUMBER: 14079-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KCNA3 (14079-1-AP) by Proteintech is a Polyclonal antibody targeting KCNA3 in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples 14079-1-AP targets KCNA3 in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, mouse thymus tissue Positive IF-P detected in: Rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Kv1.3 ( also known as KCNA3, MK3, HGK5, HLK3, PCN3, HPCN3) contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T cell proliferation and activation. Kv1.3 channels are expressed in in various tissues and cell types including brain, vascular smooth muscle cells and leucocytes. Malfunction of Kv1.3 can alter the immune response, elicit neurotoxic effects or impact on cancer growth(PMID: 24305723; 24133455). 14079-1-AP can detect two isoforms of Kv1.3 other than the canonical channel (60 KDa) : A longer isoform (70 KDa) and a truncated isoform (43 KDa). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5204 Product name: Recombinant human KCNA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-226 aa of BC035059 Sequence: DERLSLLRSPPPPSARHRAHPPQRPASSGGAHTLVNHGYAEPAAGRELPPDMTVVPGDHLLEPEVADGGGAPPQGGCGGGGCDRYEPLPPSLPAAGEQDCCGERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEY Predict reactive species Full Name: potassium voltage-gated channel, shaker-related subfamily, member 3 Calculated Molecular Weight: 575 aa, 64 kDa Observed Molecular Weight: 52 kDa, 75 kDa GenBank Accession Number: BC035059 Gene Symbol: KCNA3 Gene ID (NCBI): 3738 RRID: AB_2878011 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P22001 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924