Proteintech, 14095-1-AP, HTRA4 Polyclonal antibody

Size: 20ul / 150ul The HTRA4 (14095-1-AP) by Proteintech is a Polyclonal antibody targeting HTRA4 in WB, ELISA applications with reactivity to human, mouse, rat samples 14095-1-AP targets HTRA4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5227 Product name: Recombinant human HTRA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 128-476 aa of BC057765 Sequence: ALRAENRAARRLGKVPAVPVQWGNCGDTGTRSAGPLRRNYNFIAAVVEKVAPSVVHVQLWGRLLHGSRLVPVYSGSGFIVSEDGLIITNAHVVRNQQWIEVVLQNGARYEAVVKDIDLKLDLAVIKIESNAELPVLMLGRSSDLRAGEFVVALGSPFSLQNTATAGIVSTKQRGGKELGMKDSDMDYVQIDATINYGNSGGPLVNLDGDVIGVNSLRVTDGISFAIPSDRVRQFLAEYHEHQMKGKAFSNKKYLGLQMLSLTVPLSEELKMHYPDFPDVSSGVYVCKVFEGTAAQSSGLRDHDVIVNINGKPITTTTDVVKALDSDSLSMAVLRGKDNLLLTVIPETIN Predict reactive species Full Name: HtrA serine peptidase 4 Calculated Molecular Weight: 476 aa, 51 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC057765 Gene Symbol: HTRA4 Gene ID (NCBI): 203100 RRID: AB_10859093 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P83105 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.