Proteintech, 14100-1-AP, UBL3 Polyclonal antibody

Size: 20ul / 150ul The UBL3 (14100-1-AP) by Proteintech is a Polyclonal antibody targeting UBL3 in WB, ELISA applications with reactivity to human, mouse, rat samples 14100-1-AP targets UBL3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Caco-2 cells, human brain tissue, U-87 MG cells, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Ubiquitin-like 3 (UBL3)/membrane-anchored Ub-fold protein (MUB) acts as a post-translational modification (PTM) factor to regulate efficient protein sorting to sEVs (small extracellular vesicles). (PMID: 31363817, PMID: 30258067). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5233 Product name: Recombinant human UBL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC059385 Sequence: MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL Predict reactive species Full Name: ubiquitin-like 3 Calculated Molecular Weight: 117 aa, 13 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC059385 Gene Symbol: UBL3 Gene ID (NCBI): 5412 RRID: AB_2212060 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95164 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.