Proteintech, 14103-1-AP, PRRG1 Polyclonal antibody

Size: 20ul / 150ul The PRRG1 (14103-1-AP) by Proteintech is a Polyclonal antibody targeting PRRG1 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 14103-1-AP targets PRRG1 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells Positive IP detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5236 Product name: Recombinant human PRRG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 102-218 aa of BC060833 Sequence: WRCFLRNKTRRQTVTEGHIPFPQHLNIITPPPPPDEVFDSSGLSPGFLGYVVGRSDSVSTRLSNCDPPPTYEEATGQVNLQRSETEPHLDPPPEYEDIVNSNSASAIPMVPVVTTIK Predict reactive species Full Name: proline rich Gla (G-carboxyglutamic acid) 1 Calculated Molecular Weight: 218 aa, 23 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC060833 Gene Symbol: PRRG1 Gene ID (NCBI): 5638 RRID: AB_2878013 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14668 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.