Proteintech, 14111-1-AP, FOXR2 Polyclonal antibody

Size: 20ul / 150ul The FOXR2 (14111-1-AP) by Proteintech is a Polyclonal antibody targeting FOXR2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 14111-1-AP targets FOXR2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SH-SY5Y cells Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5257 Product name: Recombinant human FOXR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-311 aa of BC012934 Sequence: MDLKLKDCEFWYSLHGQVPGLLDWDMRNELFLPCTTDQCSLAEQILAKYRVGVMKPPEMPQKRRPSPDGDGPPCEPNLWMWVDPNILCPLGSQEAPKPSGKEDLTNISPFPQPPQKDEGSNCSEDKVVESLPSSSSEQSPLQKQGIHSPSDFELTEEEAEEPDDNSLQSPEMKCYQSQKLWQINNQEKSWQRPPLNCSHLIALALRNNPHCGLSVQEIYNFTRQHFPFFWTAPDGWKSTIHYNLCFLDSFEKVPDSLKDEDNARPRSCLWKLTKEGHRRFWEETRVLAFAQRERIQECMSQPELLTSLFDL Predict reactive species Full Name: forkhead box R2 Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC012934 Gene Symbol: FOXR2 Gene ID (NCBI): 139628 RRID: AB_2878015 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6PJQ5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.