Iright
BRAND / VENDOR: Proteintech

Proteintech, 14116-1-AP, ASPH Polyclonal antibody

CATALOG NUMBER: 14116-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ASPH (14116-1-AP) by Proteintech is a Polyclonal antibody targeting ASPH in WB, IHC, ELISA applications with reactivity to human, mouse samples 14116-1-AP targets ASPH in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, A549 cells, human brain tissue, rat brain tissue Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Aspartate-β-hydroxylase (ASPH; termed AAH in older literature) has been implicated in the cross-talk among all of these signaling pathways. Correspondingly, ASPH is expressed at high levels in many malignant neoplasms of different histogeneses. It has the 86-141 kDa bands (native and phosphorylated forms), cleavage products of 35-56 and 22-26 kDa.(PMID:27981247/PMID: 10956665) Specification Tested Reactivity: human, mouse Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5265 Product name: Recombinant human ASPH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-203 aa of BC066929 Sequence: MAQRKNAKSSGNSSSSGSGSGSTSAGSSSPGARRETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVDYEEVLAKAKDFRYNLSEVLQGKLGIYDADGDGDFDVDDAKVLLGLTKDGSNENIDSLEEVLNILAEESSDWFYGFLSFLYDIMTPFEMLEEEEEESETADGVDGTSQNEGVQGKTCVILDLHNQ Predict reactive species Full Name: aspartate beta-hydroxylase Calculated Molecular Weight: 86 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC066929 Gene Symbol: ASPH Gene ID (NCBI): 444 RRID: AB_2060148 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q12797 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924