Proteintech, 14118-1-AP, FLAD1 Polyclonal antibody

Size: 20ul / 150ul The FLAD1 (14118-1-AP) by Proteintech is a Polyclonal antibody targeting FLAD1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 14118-1-AP targets FLAD1 in WB, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, HEK-293 cells, HepG2 cells, rat liver tissue, L02 cells, mouse liver tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information FLAD1 is a protein-coding gene for flavin adenine dinucleotide synthetase (FADS), a key enzyme in the FAD biosynthesis process which contains an N-terminal molybdopterin -binding (MPTb) domain and a C-terminal domain (FADS domain) (PMID: 32714079). Alternative splicing of the human FLAD1 gene generates different isoforms of the enzyme FAD synthase. ~60 and ~50 kDa bands correspond to the expected mitochondrial FADS1 and cytosolic FADS2 proteins, respectively (PMID: 29316637). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5267 Product name: Recombinant human FLAD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 148-447 aa of BC011378 Sequence: LVSVRNVYLFPGIPELLRRVLEGMKGLFQNPAVQFHSKELYVAADEASIAPILAEAQAHFGRRLGLGSYPDWGSNYYQVKLTLDSEEEGPLEECLAYLTARLPQGSLVPYMPNAVEQASEAVYKLAESGSSLGKKVAGALQTIETSLAQYSLTQLCVGFNGGKDCTALLHLFHAAVQRKLPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEAVLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLLDWTYRDIWDFLRQLFVPYCILYDRG Predict reactive species Full Name: FAD1 flavin adenine dinucleotide synthetase homolog (S. cerevisiae) Calculated Molecular Weight: 446 aa, 49 kDa Observed Molecular Weight: 50 kDa, 65-70 kDa GenBank Accession Number: BC011378 Gene Symbol: FLAD1 Gene ID (NCBI): 80308 RRID: AB_2878017 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NFF5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.