Iright
BRAND / VENDOR: Proteintech

Proteintech, 14134-1-AP, Beta ENaC Polyclonal antibody

CATALOG NUMBER: 14134-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Beta ENaC (14134-1-AP) by Proteintech is a Polyclonal antibody targeting Beta ENaC in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14134-1-AP targets Beta ENaC in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells, mouse kidney tissue Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SCNN1B, also named as SCNEB, ENaCB, Beta-NaCH and Beta-ENaC, belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family and SCNN1B subfamily. Sodium permeable non-voltage-sensitive ion channel is inhibited by the diuretic amiloride. SCNN1B mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. It controls the reabsorption of sodium in kidney, colon, lung and sweat glands. SCNN1B plays a role in taste perception. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5348 Product name: Recombinant human β-ENaC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 68-401 aa of BC036352 Sequence: GIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEWYILQATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNC Predict reactive species Full Name: sodium channel, nonvoltage-gated 1, beta Calculated Molecular Weight: 640 aa, 73 kDa Observed Molecular Weight: 75-80 kDa GenBank Accession Number: BC036352 Gene Symbol: Beta ENaC Gene ID (NCBI): 6338 RRID: AB_2184378 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P51168 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924