Proteintech, 14141-1-AP, TMED4 Polyclonal antibody

Size: 20ul / 150ul The TMED4 (14141-1-AP) by Proteintech is a Polyclonal antibody targeting TMED4 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 14141-1-AP targets TMED4 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, HepG2 cells, rat liver tissue Positive IP detected in: mouse liver tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5234 Product name: Recombinant human TMED4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-193 aa of BC057851 Sequence: GLYFHIGETEKRCFIEEIPDETMVIGNYRTQMWDKQKEVFLPSTPGLGMHVEVKDPDGKVVLSRQYGSEGRFTFTSHTPGDHQICLHSNSTRMALFAGGKLRVHLDIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYREERFRLTSESTNQ Predict reactive species Full Name: transmembrane emp24 protein transport domain containing 4 Calculated Molecular Weight: 227 aa, 26 kDa Observed Molecular Weight: 24-26 kDa GenBank Accession Number: BC057851 Gene Symbol: TMED4 Gene ID (NCBI): 222068 RRID: AB_10642696 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z7H5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.