Iright
BRAND / VENDOR: Proteintech

Proteintech, 14143-1-AP, Synaptoporin Polyclonal antibody

CATALOG NUMBER: 14143-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Synaptoporin (14143-1-AP) by Proteintech is a Polyclonal antibody targeting Synaptoporin in WB, IHC, IF-Fro, IP, ELISA applications with reactivity to human, mouse, rat samples 14143-1-AP targets Synaptoporin in WB, IHC, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human brain tissue, mouse cerebellum tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissue, human colon tissue, human gliomas tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-Fro detected in: rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5307 Product name: Recombinant human SYNPR protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 15-265 aa of BC022518 Sequence: FATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFRLHQVTFEVPTCEGKERQKLALIGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIVTVVFSFLWLVGSSAWAKGLSDVKVATDPKEVLLLMSACKQPSNKCMAIHSPVMSSLNTSVVFGFLNFILWAGNIWFVFKETGWHSSGQRYLSDPMEKHSSSYNQGGYNQDSYGSSSGYSQQASLGPTSDEFGQQPTGPTSFTNQI Predict reactive species Full Name: synaptoporin Calculated Molecular Weight: 265 aa, 29 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC022518 Gene Symbol: Synaptoporin Gene ID (NCBI): 132204 RRID: AB_2878022 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TBG9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924