Iright
BRAND / VENDOR: Proteintech

Proteintech, 14144-1-AP, LMX1A Polyclonal antibody

CATALOG NUMBER: 14144-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LMX1A (14144-1-AP) by Proteintech is a Polyclonal antibody targeting LMX1A in WB, ELISA applications with reactivity to mouse, rat samples 14144-1-AP targets LMX1A in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information LMX1A is a transcription factor that positively regulates insulin gene transcription. LMX1A also plays a role in the development of dopamine-producing neurons during embryogenesis (PMID: 36381759). LMX1A has 2 isoforms with the molecular mass of 15 kDa (LMX1A-4AB) and 43 kDa (Isoform 1). LMX1A-4AB is expressed in testis. Isoform 1 of LMX1A is expressed in many tissues but not found in heart, liver, spleen and testis. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5311 Product name: Recombinant human LMX1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 283-382 aa of BC066353 Sequence: MEGIMNPYTALPTPQQLLAIEQSVYSSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGDCFLATSEAGPLQSRVGNPIDHLYSMQNSYFTS Predict reactive species Full Name: LIM homeobox transcription factor 1, alpha Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC066353 Gene Symbol: LMX1A Gene ID (NCBI): 4009 RRID: AB_3085429 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TE12 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924